PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462898247
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 261aa    MW: 29690.5 Da    PI: 9.5775
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462898247genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.82.1e-312575151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+iifss+g+lyeys+
  462898247 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIIFSSRGRLYEYSN 75
               79***********************************************95 PP

2K-box90.82.5e-30931894100
      K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                ss   ++e + ++++qe akLk++i nLq+++R l+G+ + ++++++L+qLe +L+k+l kiR++Knell++++e++ ++e elq++n +L++++ee
  462898247  93 SSAGTTAEITIQHYKQETAKLKQQITNLQNSNRTLIGDAIATMNHRDLKQLEARLDKGLGKIRARKNELLCSELEYMERREMELQNDNLYLKNRVEE 189
                44555788899*********************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002653.30E-411791No hitNo description
SMARTSM004321.1E-361776IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-301939IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-312091IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.4172177IPR002100Transcription factor, MADS-box
PfamPF003193.6E-262673IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-303954IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-305475IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.636103193IPR002487Transcription factor, K-box
PfamPF014865.1E-23103187IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MSPGSGSAEA ASEKSAGKGK KVEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEIA  60
LIIFSSRGRL YEYSNNSVRA TIERYKKVTS DNSSAGTTAE ITIQHYKQET AKLKQQITNL  120
QNSNRTLIGD AIATMNHRDL KQLEARLDKG LGKIRARKNE LLCSELEYME RREMELQNDN  180
LYLKNRVEEN ERAKQTANMM GTPSTSEYQQ SFLPYDPIRS FLQFSIMQQQ QPPPQPQPSQ  240
CYPQPQDDRN SSIWINGPSA T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D4e-192085368Myocyte-specific enhancer factor 2A
3mu6_C4e-192085368Myocyte-specific enhancer factor 2A
3mu6_B4e-192085368Myocyte-specific enhancer factor 2A
3mu6_A4e-192085368Myocyte-specific enhancer factor 2A
1tqe_S4e-192085469Myocyte-specific enhancer factor 2B
1tqe_R4e-192085469Myocyte-specific enhancer factor 2B
1tqe_Q4e-192085469Myocyte-specific enhancer factor 2B
1tqe_P4e-192085469Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960599.11e-140PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-123MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLQ418761e-133Q41876_MAIZE; Uncharacterized protein
STRINGGRMZM2G052890_P011e-132(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.13e-79MIKC_MADS family protein